Lineage for d2fd6u2 (2fd6 U:189-275)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890476Protein Urokinase plasminogen activator surface receptor, UPAR [161130] (1 species)
    duplication; comprises three domains of this fold
  7. 890477Species Human (Homo sapiens) [TaxId:9606] [161131] (4 PDB entries)
    Uniprot Q03405 111-210! Uniprot Q03405 114-210! Uniprot Q03405 211-297! Uniprot Q03405 211-301! Uniprot Q03405 23-102! Uniprot Q03405 23-104
  8. 890479Domain d2fd6u2: 2fd6 U:189-275 [145160]
    Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l1, d2fd6l2
    complexed with edo, etx, fuc, nag, pg4, pge, so4

Details for d2fd6u2

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOP Domain Sequences for d2fd6u2:

Sequence, based on SEQRES records: (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
hahlgdafsmnhidvscctksgcnhpd

Sequence, based on observed residues (ATOM records): (download)

>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]}
qngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmcq
lgdafsmnhidvscctksgcnhpd

SCOP Domain Coordinates for d2fd6u2:

Click to download the PDB-style file with coordinates for d2fd6u2.
(The format of our PDB-style files is described here.)

Timeline for d2fd6u2: