SCOPe 2.04: Domain d2fd6h1: 2fd6 H:1-113

Lineage for d2fd6h1 (2fd6 H:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d2fd6h1: 2fd6 H:1-113 [145155]
   Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h2, d2fd6l1, d2fd6l2, d2fd6u1, d2fd6u2, d2fd6u3
   complexed with edo, etx, nag, ndg, pg4, pge, so4

Details for d2fd6h1

PDB Entry: 2fd6, 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a

PDB Compounds: (H:) H chain of Fab of ATN-615 anti-uPAR antibody

SCOPe Domain Sequences for d2fd6h1:

Sequence; same for both SEQRES and ATOM records:

>d2fd6h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvss

Timeline for d2fd6h1:

• d2fd6h1 first appeared in SCOP 1.75
  
• d2fd6h1 appears in SCOPe 2.03
  
• d2fd6h1 appears in SCOPe 2.05
  
• d2fd6h1 appears in the current release, SCOPe 2.08