Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries) |
Domain d2f54e1: 2f54 E:1-112 [145144] Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b2, d2f54b3, d2f54d2, d2f54e2, d2f54f1, d2f54f2, d2f54g2, d2f54g3, d2f54k2, d2f54l2 automatically matched to 2BNQ E:2-113 |
PDB Entry: 2f54 (more details), 2.7 Å
SCOPe Domain Sequences for d2f54e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f54e1 b.1.1.1 (E:1-112) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle
Timeline for d2f54e1: