SCOPe 2.03: Domain d2f53e2: 2f53 E:113-241

Lineage for d2f53e2 (2f53 E:113-241)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (31 PDB entries)
Domain d2f53e2: 2f53 E:113-241 [145141]
Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53d1, d2f53e1
complexed with gol, na

Details for d2f53e2

PDB Entry: 2f53 (more details), 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity

PDB Compounds: (E:) T-cell receptor, beta chain

SCOPe Domain Sequences for d2f53e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f53e2 b.1.1.2 (E:113-241) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2f53e2:

Click to download the PDB-style file with coordinates for d2f53e2.
(The format of our PDB-style files is described here.)

Timeline for d2f53e2: