Lineage for d2f53e1 (2f53 E:1-112)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931508Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 931513Domain d2f53e1: 2f53 E:1-112 [145140]
    Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53d2, d2f53e2
    complexed with gol, na

Details for d2f53e1

PDB Entry: 2f53 (more details), 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
PDB Compounds: (E:) T-cell receptor, beta chain

SCOPe Domain Sequences for d2f53e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f53e1 b.1.1.1 (E:1-112) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvsvgmtdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

SCOPe Domain Coordinates for d2f53e1:

Click to download the PDB-style file with coordinates for d2f53e1.
(The format of our PDB-style files is described here.)

Timeline for d2f53e1: