SCOPe 2.05: Domain d2f53d2: 2f53 D:115-191

Lineage for d2f53d2 (2f53 D:115-191)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
Domain d2f53d2: 2f53 D:115-191 [145139]
Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53d1, d2f53e1
complexed with gol, na

Details for d2f53d2

PDB Entry: 2f53 (more details), 2.1 Å

PDB Description: directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity

PDB Compounds: (D:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d2f53d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f53d2 b.1.1.2 (D:115-191) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafn

SCOPe Domain Coordinates for d2f53d2:

Click to download the PDB-style file with coordinates for d2f53d2.
(The format of our PDB-style files is described here.)

Timeline for d2f53d2: