Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries) |
Domain d2f53d2: 2f53 D:115-191 [145139] Other proteins in same PDB: d2f53a1, d2f53a2, d2f53b1, d2f53d1, d2f53e1 complexed with gol, na |
PDB Entry: 2f53 (more details), 2.1 Å
SCOPe Domain Sequences for d2f53d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f53d2 b.1.1.2 (D:115-191) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafn
Timeline for d2f53d2: