![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88674] (2 PDB entries) |
![]() | Domain d2f43a2: 2f43 A:23-94 [145132] Other proteins in same PDB: d2f43a1, d2f43a3, d2f43b1, d2f43b2, d2f43b3, d2f43g1 automatically matched to d1maba2 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f43a2 b.49.1.1 (A:23-94) F1 ATP synthase alpha subunit, domain 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli kegdivkrtgai
Timeline for d2f43a2:
![]() Domains from other chains: (mouse over for more information) d2f43b1, d2f43b2, d2f43b3, d2f43g1 |