Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88925] (2 PDB entries) |
Domain d2f43a1: 2f43 A:380-502 [145131] Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43b3, d2f43g1 automatically matched to d1maba1 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f43a1 a.69.1.1 (A:380-502) F1 ATP synthase alpha subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklke ivt
Timeline for d2f43a1:
View in 3D Domains from other chains: (mouse over for more information) d2f43b1, d2f43b2, d2f43b3, d2f43g1 |