SCOPe 2.02: Domain d2f43a1: 2f43 A:380-502

Lineage for d2f43a1 (2f43 A:380-502)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88925] (2 PDB entries)

8. Domain d2f43a1: 2f43 A:380-502 [145131]
   Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43b3, d2f43g1
   automatically matched to d1maba1
   complexed with adp, atp, mg, vo4

Details for d2f43a1

PDB Entry: 2f43, 3 Å

PDB Description: Rat liver F1-ATPase

PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a1:

Sequence; same for both SEQRES and ATOM records:

>d2f43a1 a.69.1.1 (A:380-502) F1 ATP synthase alpha subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirsdgkiseqsdaklke
ivt

Timeline for d2f43a1:

• d2f43a1 first appeared in SCOP 1.75
  
• d2f43a1 appears in SCOPe 2.01
  
• d2f43a1 appears in SCOPe 2.03
  
• d2f43a1 appears in the current release, SCOPe 2.08