Lineage for d2ez0b1 (2ez0 B:18-458)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253245Protein Clc chloride channel [69913] (2 species)
  7. 2253246Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 2253276Domain d2ez0b1: 2ez0 B:18-458 [145129]
    Other proteins in same PDB: d2ez0d1, d2ez0d2, d2ez0f1, d2ez0f2
    automatically matched to 2EZ0 A:17-460
    complexed with br; mutant

Details for d2ez0b1

PDB Entry: 2ez0 (more details), 3.54 Å

PDB Description: crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2ez0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez0b1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggagipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplasailartlakqea

SCOPe Domain Coordinates for d2ez0b1:

Click to download the PDB-style file with coordinates for d2ez0b1.
(The format of our PDB-style files is described here.)

Timeline for d2ez0b1: