Lineage for d2ez0a1 (2ez0 A:17-460)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024422Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 3024423Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 3024424Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 3024425Protein Clc chloride channel [69913] (2 species)
  7. 3024426Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 3024455Domain d2ez0a1: 2ez0 A:17-460 [145128]
    Other proteins in same PDB: d2ez0d1, d2ez0d2, d2ez0f1, d2ez0f2
    complexed with br; mutant

Details for d2ez0a1

PDB Entry: 2ez0 (more details), 3.54 Å

PDB Description: crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2ez0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez0a1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggagipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplasailartlakqeaeq

SCOPe Domain Coordinates for d2ez0a1:

Click to download the PDB-style file with coordinates for d2ez0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ez0a1: