SCOPe 2.02: Domain d2esvd2: 2esv D:117-205

Lineage for d2esvd2 (2esv D:117-205)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)
Domain d2esvd2: 2esv D:117-205 [145125]
Other proteins in same PDB: d2esva1, d2esva2, d2esvb_, d2esvd1, d2esve1
complexed with iod

Details for d2esvd2

PDB Entry: 2esv (more details), 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex

PDB Compounds: (D:) KK50.4 T cell receptor alpha chain

SCOPe Domain Sequences for d2esvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esvd2 b.1.1.2 (D:117-205) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2esvd2:

Click to download the PDB-style file with coordinates for d2esvd2.
(The format of our PDB-style files is described here.)

Timeline for d2esvd2: