SCOP 1.75: Domain d2esvd2: 2esv D:117-205

Lineage for d2esvd2 (2esv D:117-205)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)

8. Domain d2esvd2: 2esv D:117-205 [145125]
   Other proteins in same PDB: d2esva1, d2esva2, d2esvb1, d2esvd1, d2esve1
   complexed with iod

Details for d2esvd2

PDB Entry: 2esv, 2.6 Å

PDB Description: structure of the hla-e-vmaprtlil/kk50.4 tcr complex

PDB Compounds: (D:) KK50.4 T cell receptor alpha chain

SCOP Domain Sequences for d2esvd2:

Sequence; same for both SEQRES and ATOM records:

>d2esvd2 b.1.1.2 (D:117-205) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d2esvd2:

• d2esvd2 is new in SCOP 1.75
  
• d2esvd2 appears in SCOPe 2.01
  
• d2esvd2 appears in the current release, SCOPe 2.08