Lineage for d2eqbc_ (2eqb C:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969505Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 1969506Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 1969507Protein Rab guanine nucleotide exchange factor Sec2 [144286] (2 species)
  7. 1969508Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
    Uniprot P17065 16-162! Uniprot P17065 31-144
  8. 1969510Domain d2eqbc_: 2eqb C: [145121]
    Other proteins in same PDB: d2eqba_
    automated match to d2eqbb1
    complexed with po4

Details for d2eqbc_

PDB Entry: 2eqb (more details), 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex
PDB Compounds: (C:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2eqbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eqbc_ h.1.33.1 (C:) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslf
deannmvadarkekyaieilnkrlteqlrekdt

SCOPe Domain Coordinates for d2eqbc_:

Click to download the PDB-style file with coordinates for d2eqbc_.
(The format of our PDB-style files is described here.)

Timeline for d2eqbc_: