SCOPe 2.01: Domain d2eqbc1: 2eqb C:51-142

Lineage for d2eqbc1 (2eqb C:51-142)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family)
   dimeric coiled coil

5. Family h.1.33.1: Sec2 N-terminal region [144285] (1 protein)

6. Protein Rab guanine nucleotide exchange factor Sec2 [144286] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [144287] (3 PDB entries)
   Uniprot P17065 16-162! Uniprot P17065 31-144

8. Domain d2eqbc1: 2eqb C:51-142 [145121]
   Other proteins in same PDB: d2eqba_
   automatically matched to 2EQB B:51-142
   complexed with po4

Details for d2eqbc1

PDB Entry: 2eqb, 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex

PDB Compounds: (C:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2eqbc1:

Sequence; same for both SEQRES and ATOM records:

>d2eqbc1 h.1.33.1 (C:51-142) Rab guanine nucleotide exchange factor Sec2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nynqlkedyntlkrelsdrddevkrlrediakenelrtkaeeeadklnkevedltaslfd
eannmvadarkekyaieilnkrlteqlrekdt

Timeline for d2eqbc1:

• d2eqbc1 first appeared in SCOP 1.75
  
• d2eqbc1 appears in SCOPe 2.02
  
• d2eqbc1 appears in the current release, SCOPe 2.08, called d2eqbc2