Lineage for d2e76e1 (2e76 E:1-32)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698541Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 1698542Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 1698543Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 1698546Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries)
  8. 1698550Domain d2e76e1: 2e76 E:1-32 [145118]
    Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76d2, d2e76f1, d2e76g1, d2e76h1
    automatically matched to 2D2C E:1-32
    complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76e1

PDB Entry: 2e76 (more details), 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus
PDB Compounds: (E:) Cytochrome b6-f complex subunit 6

SCOPe Domain Sequences for d2e76e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e76e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

SCOPe Domain Coordinates for d2e76e1:

Click to download the PDB-style file with coordinates for d2e76e1.
(The format of our PDB-style files is described here.)

Timeline for d2e76e1: