SCOPe 2.03: Domain d2e76e1: 2e76 E:1-32

Lineage for d2e76e1 (2e76 E:1-32)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family)

5. Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)

6. Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103439] (6 PDB entries)

8. Domain d2e76e1: 2e76 E:1-32 [145118]
   Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76d2, d2e76f1, d2e76g1, d2e76h1
   automatically matched to 2D2C E:1-32
   complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76e1

PDB Entry: 2e76, 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus

PDB Compounds: (E:) Cytochrome b6-f complex subunit 6

SCOPe Domain Sequences for d2e76e1:

Sequence; same for both SEQRES and ATOM records:

>d2e76e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

Timeline for d2e76e1:

• d2e76e1 first appeared in SCOP 1.75
  
• d2e76e1 appears in SCOPe 2.02
  
• d2e76e1 appears in SCOPe 2.04
  
• d2e76e1 appears in the current release, SCOPe 2.08