Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) |
Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries) |
Domain d2e76e1: 2e76 E:1-32 [145118] Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76d2, d2e76f1, d2e76g1, d2e76h1 automatically matched to 2D2C E:1-32 complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq |
PDB Entry: 2e76 (more details), 3.41 Å
SCOPe Domain Sequences for d2e76e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e76e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} milgavfyivfialffgiavgiifaiksikli
Timeline for d2e76e1: