SCOPe 2.04: Domain d2e75e1: 2e75 E:1-32

Lineage for d2e75e1 (2e75 E:1-32)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family)

5. Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)

6. Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries)

8. Domain d2e75e1: 2e75 E:1-32 [145115]
   Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75d2, d2e75f1, d2e75g1, d2e75h1
   automatically matched to 2D2C E:1-32
   complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75e1

PDB Entry: 2e75, 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus

PDB Compounds: (E:) Cytochrome b6-f complex subunit 6

SCOPe Domain Sequences for d2e75e1:

Sequence; same for both SEQRES and ATOM records:

>d2e75e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

Timeline for d2e75e1:

• d2e75e1 first appeared in SCOP 1.75
  
• d2e75e1 appears in SCOPe 2.03
  
• d2e75e1 appears in SCOPe 2.05
  
• d2e75e1 appears in the current release, SCOPe 2.08