Lineage for d2e75e1 (2e75 E:1-32)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238686Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 1238687Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 1238688Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 1238691Species Mastigocladus laminosus [TaxId:83541] [103439] (6 PDB entries)
  8. 1238697Domain d2e75e1: 2e75 E:1-32 [145115]
    Other proteins in same PDB: d2e75a1, d2e75b1, d2e75d1, d2e75d2, d2e75f1, d2e75g1, d2e75h1
    automatically matched to 2D2C E:1-32
    complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq

Details for d2e75e1

PDB Entry: 2e75 (more details), 3.55 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide (NQNO) from M.laminosus
PDB Compounds: (E:) Cytochrome b6-f complex subunit 6

SCOPe Domain Sequences for d2e75e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e75e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

SCOPe Domain Coordinates for d2e75e1:

Click to download the PDB-style file with coordinates for d2e75e1.
(The format of our PDB-style files is described here.)

Timeline for d2e75e1: