Lineage for d2e74e1 (2e74 E:1-32)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958350Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 1958351Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 1958352Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 1958355Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries)
  8. 1958356Domain d2e74e1: 2e74 E:1-32 [145112]
    Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74d2, d2e74f_, d2e74g_, d2e74h_
    automatically matched to 2D2C E:1-32
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74e1

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (E:) Cytochrome b6-f complex subunit 6

SCOPe Domain Sequences for d2e74e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74e1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

SCOPe Domain Coordinates for d2e74e1:

Click to download the PDB-style file with coordinates for d2e74e1.
(The format of our PDB-style files is described here.)

Timeline for d2e74e1: