Lineage for d2e74b1 (2e74 B:1-160)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959225Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1959226Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1959227Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1959272Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 1959275Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
  8. 1959276Domain d2e74b1: 2e74 B:1-160 [145111]
    Other proteins in same PDB: d2e74a_, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74g_, d2e74h_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74b1

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2e74b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74b1 f.32.1.1 (B:1-160) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d2e74b1:

Click to download the PDB-style file with coordinates for d2e74b1.
(The format of our PDB-style files is described here.)

Timeline for d2e74b1: