Lineage for d2dypd1 (2dyp D:3-96)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935313Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 935576Protein Ligand binding domain of lir-2 (ilt4) [158879] (1 species)
  7. 935577Species Human (Homo sapiens) [TaxId:9606] [158880] (1 PDB entry)
    Uniprot Q8N423 120-218! Uniprot Q8N423 26-109
  8. 935578Domain d2dypd1: 2dyp D:3-96 [145108]
    Other proteins in same PDB: d2dypa1, d2dypa2, d2dypb_

Details for d2dypd1

PDB Entry: 2dyp (more details), 2.5 Å

PDB Description: crystal structure of lilrb2(lir2/ilt4/cd85d) complexed with hla-g
PDB Compounds: (D:) Leukocyte immunoglobulin-like receptor subfamily B member 2

SCOPe Domain Sequences for d2dypd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dypd1 b.1.1.4 (D:3-96) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]}
ipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekksaswitrirpelvkngqfri
psitwehtgrygcqyysrarwselsdplvlvmtg

SCOPe Domain Coordinates for d2dypd1:

Click to download the PDB-style file with coordinates for d2dypd1.
(The format of our PDB-style files is described here.)

Timeline for d2dypd1: