Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Ligand binding domain of lir-2 (ilt4) [158879] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158880] (1 PDB entry) Uniprot Q8N423 120-218! Uniprot Q8N423 26-109 |
Domain d2dypd1: 2dyp D:3-96 [145108] Other proteins in same PDB: d2dypa1, d2dypa2, d2dypb_ |
PDB Entry: 2dyp (more details), 2.5 Å
SCOPe Domain Sequences for d2dypd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dypd1 b.1.1.4 (D:3-96) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]} ipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekksaswitrirpelvkngqfri psitwehtgrygcqyysrarwselsdplvlvmtg
Timeline for d2dypd1: