Lineage for d2dtge6 (2dtg E:157-311)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240879Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 1240880Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1240905Protein Insulin receptor [161122] (1 species)
  7. 1240906Species Human (Homo sapiens) [TaxId:9606] [161123] (1 PDB entry)
    Uniprot P06213 184-338
  8. 1240907Domain d2dtge6: 2dtg E:157-311 [145105]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge4, d2dtge5

Details for d2dtge6

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc
sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq
yvihnnkcipecpsgytmnssnllctpclgpcpkv

SCOPe Domain Coordinates for d2dtge6:

Click to download the PDB-style file with coordinates for d2dtge6.
(The format of our PDB-style files is described here.)

Timeline for d2dtge6: