Lineage for d2dtge4 (2dtg E:4-156)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834828Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1834854Protein Insulin receptor [159452] (1 species)
  7. 1834855Species Human (Homo sapiens) [TaxId:9606] [159453] (1 PDB entry)
    Uniprot P06213 31-183! Uniprot P06213 339-494
  8. 1834856Domain d2dtge4: 2dtg E:4-156 [145103]
    Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge1, d2dtge2, d2dtge3, d2dtge6

Details for d2dtge4

PDB Entry: 2dtg (more details), 3.8 Å

PDB Description: insulin receptor (ir) ectodomain in complex with fab's
PDB Compounds: (E:) Insulin receptor

SCOPe Domain Sequences for d2dtge4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtge4 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
pgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylll
frvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknn
elcylatidwsrildsvednhivlnkddneecg

SCOPe Domain Coordinates for d2dtge4:

Click to download the PDB-style file with coordinates for d2dtge4.
(The format of our PDB-style files is described here.)

Timeline for d2dtge4: