Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Insulin receptor [158901] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158902] (1 PDB entry) Uniprot P06213 495-618 |
Domain d2dtge1: 2dtg E:808-909 [145100] Other proteins in same PDB: d2dtga1, d2dtgb1, d2dtgb2, d2dtgc1, d2dtgc2, d2dtgd1, d2dtge4, d2dtge5, d2dtge6 |
PDB Entry: 2dtg (more details), 3.8 Å
SCOPe Domain Sequences for d2dtge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} eakaddivgpvtheifennvvhlmwqepkepnglivlyevsyrrygdeelhlcdtrkhfa lergcrlrglspgnysvriratslagngswteptyfyvtdyl
Timeline for d2dtge1: