SCOPe 2.04: Domain d2dqhh1: 2dqh H:1-114

Lineage for d2dqhh1 (2dqh H:1-114)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)

8. Domain d2dqhh1: 2dqh H:1-114 [145086]
   Other proteins in same PDB: d2dqhl_, d2dqhy_
   mutant

Details for d2dqhh1

PDB Entry: 2dqh, 2.3 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (Hy58a) complexed with hen egg lysozyme

PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d2dqhh1:

Sequence; same for both SEQRES and ATOM records:

>d2dqhh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstayn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

Timeline for d2dqhh1:

• d2dqhh1 first appeared in SCOP 1.75
  
• d2dqhh1 appears in SCOPe 2.03
  
• d2dqhh1 appears in SCOPe 2.05
  
• d2dqhh1 appears in the current release, SCOPe 2.08