Lineage for d2dqhh1 (2dqh H:1-114)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104281Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1104308Domain d2dqhh1: 2dqh H:1-114 [145086]
    Other proteins in same PDB: d2dqhl_, d2dqhy1
    mutant

Details for d2dqhh1

PDB Entry: 2dqh (more details), 2.3 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (Hy58a) complexed with hen egg lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d2dqhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqhh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstayn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d2dqhh1:

Click to download the PDB-style file with coordinates for d2dqhh1.
(The format of our PDB-style files is described here.)

Timeline for d2dqhh1: