Lineage for d2dd8l1 (2dd8 L:3-108)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289510Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1289591Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1289596Domain d2dd8l1: 2dd8 L:3-108 [145075]
    Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8l2, d2dd8s1
    complexed with nag, po4

Details for d2dd8l1

PDB Entry: 2dd8 (more details), 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
PDB Compounds: (L:) IGG Light chain

SCOPe Domain Sequences for d2dd8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd8l1 b.1.1.1 (L:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
yeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlg

SCOPe Domain Coordinates for d2dd8l1:

Click to download the PDB-style file with coordinates for d2dd8l1.
(The format of our PDB-style files is described here.)

Timeline for d2dd8l1: