| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-G [TaxId:9606] [160076] (3 PDB entries) Uniprot P17693 25-205! Uniprot P17693 26-205 |
| Domain d2d31d2: 2d31 D:1-181 [145070] Other proteins in same PDB: d2d31a1, d2d31b1, d2d31d1, d2d31e1 automatically matched to 2D31 A:1-181 |
PDB Entry: 2d31 (more details), 3.2 Å
SCOPe Domain Sequences for d2d31d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d31d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-G [TaxId: 9606]}
gshsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsacprmeprapwveqegpeyw
eeetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrllrgyeqyaydg
kdylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlq
r
Timeline for d2d31d2:
View in 3DDomains from other chains: (mouse over for more information) d2d31a1, d2d31a2, d2d31b1, d2d31e1 |