Lineage for d2d31d2 (2d31 D:1-181)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1020887Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1021118Species Human (Homo sapiens), HLA-G [TaxId:9606] [160076] (3 PDB entries)
    Uniprot P17693 25-205! Uniprot P17693 26-205
  8. 1021122Domain d2d31d2: 2d31 D:1-181 [145070]
    Other proteins in same PDB: d2d31a1, d2d31b1, d2d31d1, d2d31e1
    automatically matched to 2D31 A:1-181

Details for d2d31d2

PDB Entry: 2d31 (more details), 3.2 Å

PDB Description: crystal structure of disulfide-linked hla-g dimer
PDB Compounds: (D:) HLA class I histocompatibility antigen, alpha chain G

SCOPe Domain Sequences for d2d31d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d31d2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-G [TaxId: 9606]}
gshsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsacprmeprapwveqegpeyw
eeetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrllrgyeqyaydg
kdylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlq
r

SCOPe Domain Coordinates for d2d31d2:

Click to download the PDB-style file with coordinates for d2d31d2.
(The format of our PDB-style files is described here.)

Timeline for d2d31d2: