Lineage for d2d31a2 (2d31 A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183006Species Human (Homo sapiens), HLA-G [TaxId:9606] [160076] (3 PDB entries)
    Uniprot P17693 25-205! Uniprot P17693 26-205
  8. 2183009Domain d2d31a2: 2d31 A:1-181 [145068]
    Other proteins in same PDB: d2d31a1, d2d31b1, d2d31d1, d2d31e1

Details for d2d31a2

PDB Entry: 2d31 (more details), 3.2 Å

PDB Description: crystal structure of disulfide-linked hla-g dimer
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain G

SCOPe Domain Sequences for d2d31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d31a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-G [TaxId: 9606]}
gshsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsacprmeprapwveqegpeyw
eeetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrllrgyeqyaydg
kdylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlq
r

SCOPe Domain Coordinates for d2d31a2:

Click to download the PDB-style file with coordinates for d2d31a2.
(The format of our PDB-style files is described here.)

Timeline for d2d31a2: