Lineage for d2d2cr1 (2d2c R:1-32)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060082Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 1060083Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 1060084Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 1060087Species Mastigocladus laminosus [TaxId:83541] [103439] (5 PDB entries)
  8. 1060094Domain d2d2cr1: 2d2c R:1-32 [145065]
    Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cd2, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cs1, d2d2ct1, d2d2cu1
    automatically matched to 2D2C E:1-32
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cr1

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (R:) Cytochrome b6-f complex subunit VI

SCOPe Domain Sequences for d2d2cr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2cr1 f.23.24.1 (R:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
milgavfyivfialffgiavgiifaiksikli

SCOPe Domain Coordinates for d2d2cr1:

Click to download the PDB-style file with coordinates for d2d2cr1.
(The format of our PDB-style files is described here.)

Timeline for d2d2cr1: