Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) |
Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103439] (7 PDB entries) |
Domain d2d2ce1: 2d2c E:1-32 [145063] Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cd2, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cq2, d2d2cs1, d2d2ct1, d2d2cu1 complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2ce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2ce1 f.23.24.1 (E:1-32) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} milgavfyivfialffgiavgiifaiksikli
Timeline for d2d2ce1: