Lineage for d2ck3c3 (2ck3 C:95-379)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364671Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 1364674Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
    Uniprot P19483
  8. 1364680Domain d2ck3c3: 2ck3 C:95-379 [145041]
    Other proteins in same PDB: d2ck3a1, d2ck3a2, d2ck3b1, d2ck3b2, d2ck3c1, d2ck3c2, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automated match to d1e79a3
    complexed with adp, anp, azi, mg, po4

Details for d2ck3c3

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (C:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d2ck3c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3c3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d2ck3c3:

Click to download the PDB-style file with coordinates for d2ck3c3.
(The format of our PDB-style files is described here.)

Timeline for d2ck3c3: