Lineage for d2ck3a2 (2ck3 A:24-94)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1129800Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1129801Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 1129802Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1129803Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1129806Species Cow (Bos taurus) [TaxId:9913] [88673] (14 PDB entries)
    Uniprot P19483
  8. 1129810Domain d2ck3a2: 2ck3 A:24-94 [145034]
    Other proteins in same PDB: d2ck3a1, d2ck3a3, d2ck3b1, d2ck3b3, d2ck3c1, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automatically matched to d1bmfc2
    complexed with adp, anp, azi, mg, po4

Details for d2ck3a2

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (A:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d2ck3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3a2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d2ck3a2:

Click to download the PDB-style file with coordinates for d2ck3a2.
(The format of our PDB-style files is described here.)

Timeline for d2ck3a2: