Lineage for d2cdec2 (2cde C:116-193)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762508Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
  8. 1762535Domain d2cdec2: 2cde C:116-193 [145030]
    Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
    automatically matched to 2CDE A:116-193

Details for d2cdec2

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (C:) inkt-tcr

SCOPe Domain Sequences for d2cdec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdec2 b.1.1.2 (C:116-193) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnn

SCOPe Domain Coordinates for d2cdec2:

Click to download the PDB-style file with coordinates for d2cdec2.
(The format of our PDB-style files is described here.)

Timeline for d2cdec2: