SCOPe 2.02: Domain d2cdec1: 2cde C:2-115

Lineage for d2cdec1 (2cde C:2-115)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (6 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)
Domain d2cdec1: 2cde C:2-115 [145029]
Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
automatically matched to 2CDE A:2-115

Details for d2cdec1

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (C:) inkt-tcr

SCOPe Domain Sequences for d2cdec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdec1 b.1.1.2 (C:2-115) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d2cdec1:

Click to download the PDB-style file with coordinates for d2cdec1.
(The format of our PDB-style files is described here.)

Timeline for d2cdec1: