Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160563] (1 PDB entry) Uniprot O14508 32-134 |
Domain d2c9wa2: 2c9w A:32-134 [145024] Other proteins in same PDB: d2c9wa1, d2c9wb_, d2c9wc_ complexed with ni, so4 |
PDB Entry: 2c9w (more details), 1.9 Å
SCOPe Domain Sequences for d2c9wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck
Timeline for d2c9wa2: