Lineage for d2c9wa2 (2c9w A:32-134)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1212958Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1212959Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1212960Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1213261Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species)
  7. 1213262Species Human (Homo sapiens) [TaxId:9606] [160563] (1 PDB entry)
    Uniprot O14508 32-134
  8. 1213263Domain d2c9wa2: 2c9w A:32-134 [145024]
    Other proteins in same PDB: d2c9wa1, d2c9wb_, d2c9wc_
    complexed with ni, so4

Details for d2c9wa2

PDB Entry: 2c9w (more details), 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d2c9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

SCOPe Domain Coordinates for d2c9wa2:

Click to download the PDB-style file with coordinates for d2c9wa2.
(The format of our PDB-style files is described here.)

Timeline for d2c9wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9wa1