SCOPe 2.02: Domain d2bnre1: 2bnr E:2-113

Lineage for d2bnre1 (2bnr E:2-113)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
Domain d2bnre1: 2bnr E:2-113 [145002]
Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb_, d2bnrd2, d2bnre2
automatically matched to 2BNQ E:2-113

Details for d2bnre1

PDB Entry: 2bnr (more details), 1.9 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (E:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d2bnre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnre1 b.1.1.1 (E:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

SCOPe Domain Coordinates for d2bnre1:

Click to download the PDB-style file with coordinates for d2bnre1.
(The format of our PDB-style files is described here.)

Timeline for d2bnre1: