SCOPe 2.07: Domain d2bnrd2: 2bnr D:115-204

Lineage for d2bnrd2 (2bnr D:115-204)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
Domain d2bnrd2: 2bnr D:115-204 [145001]
Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb2, d2bnrb3, d2bnrd1, d2bnre1
automatically matched to 2BNQ D:115-204

Details for d2bnrd2

PDB Entry: 2bnr (more details), 1.9 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d2bnrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnrd2 b.1.1.2 (D:115-204) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
yiqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2bnrd2:

Click to download the PDB-style file with coordinates for d2bnrd2.
(The format of our PDB-style files is described here.)

Timeline for d2bnrd2: