Lineage for d2bnrd2 (2bnr D:115-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749669Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2749676Domain d2bnrd2: 2bnr D:115-204 [145001]
    Other proteins in same PDB: d2bnra1, d2bnra2, d2bnrb2, d2bnrb3, d2bnrd1, d2bnre1
    automatically matched to 2BNQ D:115-204
    missing some secondary structures that made up less than one-third of the common domain

Details for d2bnrd2

PDB Entry: 2bnr (more details), 1.9 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d2bnrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnrd2 b.1.1.2 (D:115-204) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
yiqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2bnrd2:

Click to download the PDB-style file with coordinates for d2bnrd2.
(The format of our PDB-style files is described here.)

Timeline for d2bnrd2: