| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
| Domain d2bnqe2: 2bnq E:114-242 [144999] Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb_, d2bnqd1, d2bnqe1 |
PDB Entry: 2bnq (more details), 1.7 Å
SCOPe Domain Sequences for d2bnqe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnqe2 b.1.1.2 (E:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad
Timeline for d2bnqe2: