Lineage for d2bnqd1 (2bnq D:2-114)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931486Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)
  8. 931489Domain d2bnqd1: 2bnq D:2-114 [144996]
    Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb_, d2bnqd2, d2bnqe2

Details for d2bnqd1

PDB Entry: 2bnq (more details), 1.7 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (D:) T-cell receptor alpha chain v region

SCOPe Domain Sequences for d2bnqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr
lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhp

SCOPe Domain Coordinates for d2bnqd1:

Click to download the PDB-style file with coordinates for d2bnqd1.
(The format of our PDB-style files is described here.)

Timeline for d2bnqd1: