![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries) |
![]() | Domain d2bnqd1: 2bnq D:2-114 [144996] Other proteins in same PDB: d2bnqa1, d2bnqa2, d2bnqb_, d2bnqd2, d2bnqe2 |
PDB Entry: 2bnq (more details), 1.7 Å
SCOPe Domain Sequences for d2bnqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} qevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsgr lnasldkssgrstlyiaasqpgdsatylcavrptsggsyiptfgrgtslivhp
Timeline for d2bnqd1: