Lineage for d2bmkh1 (2bmk H:1-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781998Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (47 PDB entries)
    Uniprot P01796 #
    HV27_MOUSE Ig heavy chain V-III region A4
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 782028Domain d2bmkh1: 2bmk H:1-113 [144994]
    Other proteins in same PDB: d2bmka1, d2bmka2, d2bmkb2, d2bmkh2, d2bmkl1, d2bmkl2
    automatically matched to 1WC7 B:1-113
    complexed with iod, pdd

Details for d2bmkh1

PDB Entry: 2bmk (more details), 2.3 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-d-alanine
PDB Compounds: (H:) fab fragment of catalytic antibody 15a9, heavy chain

SCOP Domain Sequences for d2bmkh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmkh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
vtvss

SCOP Domain Coordinates for d2bmkh1:

Click to download the PDB-style file with coordinates for d2bmkh1.
(The format of our PDB-style files is described here.)

Timeline for d2bmkh1: