Lineage for d2bdnh1 (2bdn H:1-117)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782163Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 782187Domain d2bdnh1: 2bdn H:1-117 [144985]
    Other proteins in same PDB: d2bdna1, d2bdnh2

Details for d2bdnh1

PDB Entry: 2bdn (more details), 2.53 Å

PDB Description: crystal structure of human mcp-1 bound to a blocking antibody, 11k2
PDB Compounds: (H:) Antibody heavy chain 11K2

SCOP Domain Sequences for d2bdnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdnh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvkagasvklscpasglnikdtymhwvkqrpeqglewigridpangntkf
dpkfqgkatitadtssntaylqlssltsedtavyycargvfgffdywgqgttltvss

SCOP Domain Coordinates for d2bdnh1:

Click to download the PDB-style file with coordinates for d2bdnh1.
(The format of our PDB-style files is described here.)

Timeline for d2bdnh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bdnh2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bdna1