Lineage for d2b9n71 (2b9n 7:1-46)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1252957Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1252958Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 1252959Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 1252960Protein Ribosomal protein L34p [144323] (3 species)
  7. 1252977Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 1252992Domain d2b9n71: 2b9n 7:1-46 [144970]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to 2ZJR 2:1-46

Details for d2b9n71

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOPe Domain Sequences for d2b9n71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9n71 j.118.1.1 (7:1-46) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d2b9n71:

Click to download the PDB-style file with coordinates for d2b9n71.
(The format of our PDB-style files is described here.)

Timeline for d2b9n71: