Lineage for d2b7cb_ (2b7c B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653435Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 1653436Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)
  6. 1653440Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 1653441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (6 PDB entries)
  8. 1653443Domain d2b7cb_: 2b7c B: [144964]
    Other proteins in same PDB: d2b7ca1, d2b7ca2, d2b7ca3
    automated match to d2b7bb1
    mutant

Details for d2b7cb_

PDB Entry: 2b7c (more details), 1.8 Å

PDB Description: yeast guanine nucleotide exchange factor eef1balpha k205a mutant in complex with eef1a
PDB Compounds: (B:) elongation factor-1 beta

SCOPe Domain Sequences for d2b7cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7cb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqal

SCOPe Domain Coordinates for d2b7cb_:

Click to download the PDB-style file with coordinates for d2b7cb_.
(The format of our PDB-style files is described here.)

Timeline for d2b7cb_: