Lineage for d2b66v1 (2b66 V:5-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813870Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
    Uniprot Q9RY64 5-98
  8. 813878Domain d2b66v1: 2b66 V:5-98 [144961]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66w1, d2b66x1, d2b66y1, d2b66z1
    automatically matched to 2ZJR O:5-98

Details for d2b66v1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (V:) 50S ribosomal protein L21

SCOP Domain Sequences for d2b66v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66v1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOP Domain Coordinates for d2b66v1:

Click to download the PDB-style file with coordinates for d2b66v1.
(The format of our PDB-style files is described here.)

Timeline for d2b66v1: