Lineage for d2b6651 (2b66 5:2-59)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641696Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2641848Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2641849Protein Ribosomal protein L32p [144201] (3 species)
  7. 2641885Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 2641894Domain d2b6651: 2b66 5:2-59 [144956]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b6651

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2b6651:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b6651 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d2b6651:

Click to download the PDB-style file with coordinates for d2b6651.
(The format of our PDB-style files is described here.)

Timeline for d2b6651: