Lineage for d2b4cg1 (2b4c G:84-492)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941821Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1941822Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1941823Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1941824Protein gp120 core [56504] (2 species)
  7. 1941825Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 1941845Domain d2b4cg1: 2b4c G:84-492 [144950]
    Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2
    complexed with nag, ndg, so4, xyl

Details for d2b4cg1

PDB Entry: 2b4c (more details), 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody
PDB Compounds: (G:) Envelope glycoprotein

SCOPe Domain Sequences for d2b4cg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4cg1 d.172.1.1 (G:84-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
vvlenvtehfnmwkndmveqmqediislwdqslkpcvkltplcvgagscdtsvitqacpk
isfepipihycapagfailkcndktfngkgpcknvstvqcthgirpvvstqlllngslae
eevvirsdnftnnaktiivqlkesveinctrpnqntrksihigpgrafyttgeiigdirq
ahcnisrakwndtlkqiviklreqfenktivfnhssggdpeivmhsfncggeffycnsaq
lfnstwnnntegsnntegntitlpcrikqiinmwqevgkamyappirgqircssnitgll
ltrdgginengteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d2b4cg1:

Click to download the PDB-style file with coordinates for d2b4cg1.
(The format of our PDB-style files is described here.)

Timeline for d2b4cg1: