Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.172: gp120 core [56501] (1 superfamily) unusual fold |
Superfamily d.172.1: gp120 core [56502] (1 family) |
Family d.172.1.1: gp120 core [56503] (2 proteins) |
Protein gp120 core [56504] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries) |
Domain d2b4cg1: 2b4c G:84-492 [144950] Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4ch1, d2b4ch2, d2b4cl1, d2b4cl2 complexed with nag, ndg, so4, xyl |
PDB Entry: 2b4c (more details), 3.3 Å
SCOPe Domain Sequences for d2b4cg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4cg1 d.172.1.1 (G:84-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]} vvlenvtehfnmwkndmveqmqediislwdqslkpcvkltplcvgagscdtsvitqacpk isfepipihycapagfailkcndktfngkgpcknvstvqcthgirpvvstqlllngslae eevvirsdnftnnaktiivqlkesveinctrpnqntrksihigpgrafyttgeiigdirq ahcnisrakwndtlkqiviklreqfenktivfnhssggdpeivmhsfncggeffycnsaq lfnstwnnntegsnntegntitlpcrikqiinmwqevgkamyappirgqircssnitgll ltrdgginengteifrpgggdmrdnwrselykykvvkie
Timeline for d2b4cg1: