SCOPe 2.06: Domain d2b11d_: 2b11 D:

Lineage for d2b11d_ (2b11 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries)
   Uniprot P00044

8. Domain d2b11d_: 2b11 D: [144946]
   Other proteins in same PDB: d2b11a_, d2b11c_
   automated match to d2b11b1
   complexed with hem, znh

Details for d2b11d_

PDB Entry: 2b11, 2.3 Å

PDB Description: crystal structure of the protein-protein complex between f82w cytochrome c and cytochrome c peroxidase

PDB Compounds: (D:) Cytochrome c iso-1

SCOPe Domain Sequences for d2b11d_:

Sequence; same for both SEQRES and ATOM records:

>d2b11d_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmawgglkkekdrndlitylkkace

Timeline for d2b11d_:

• d2b11d_ first appeared in SCOP 1.75, called d2b11d1
  
• d2b11d_ appears in SCOPe 2.05
  
• d2b11d_ appears in SCOPe 2.07
  
• d2b11d_ appears in the current release, SCOPe 2.08